PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_991931CF9.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 251aa    MW: 27388.6 Da    PI: 6.787
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_991931CF9.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT+eEd  lv  ++q+G  +W++ ++  g+ R++k+c++rw +yl
  Traes_6DL_991931CF9.2 14 RGPWTAEEDMTLVAHIEQHGHSNWRALPKQAGLLRCGKSCRLRWINYL 61
                           89******************************99************97 PP

2Myb_DNA-binding54.33.1e-1767112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T eE++ +++++++lG++ W+tIa++++ gRt++++k+ w+++l
  Traes_6DL_991931CF9.2  67 RGNFTSEEEDAIIQLHAMLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 112
                            89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-24564IPR009057Homeodomain-like
PROSITE profilePS5129414.644961IPR017930Myb domain
SuperFamilySSF466899.54E-3110108IPR009057Homeodomain-like
SMARTSM007174.5E-131363IPR001005SANT/Myb domain
PfamPF002491.8E-141461IPR001005SANT/Myb domain
CDDcd001672.12E-111661No hitNo description
PROSITE profilePS5129426.01462116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2665116IPR009057Homeodomain-like
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002492.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.70E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MVRAPCCEKM GLKRGPWTAE EDMTLVAHIE QHGHSNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TSEEEDAIIQ LHAMLGNRWS TIAARLPGRT DNEIKNVWHT HLKKRLESSS  120
KPSGQAAPKR KAKKPAVSAS ALEGPTSKPA SSPGQSLSMS PGQSLSTSSA TDYSMASSLE  180
NTGSSSSSEE FQIDDSFWSE TLGMSVDNSG SGMEISDTFG VDSASPSSND EMDFWVTLFM  240
QAGDMQSLSQ I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9690510.0JN969051.1 Triticum aestivum MYB73 (MYB73) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575391.11e-133PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH42e-97MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLW5GY640.0W5GY64_WHEAT; Uncharacterized protein
STRINGMLOC_34646.11e-159(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.11e-78myb domain protein 14
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]